Structure of PDB 7ttu Chain I Binding Site BS02

Receptor Information
>7ttu Chain I (length=78) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDD
TLFAKIDGVVKFERKGRDKKQVSVYAVA
Ligand information
>7ttu Chain 2 (length=111) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagua
gaacguugcaa
...<........<<<<<<<<.....<<<<<<.............>>>>..
>>....>>>>>>.>>.<......<.<..<........>..>...>....>
......>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ttu A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R79 R82
Binding residue
(residue number reindexed from 1)		R64 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttu, PDBe:7ttu, PDBj:7ttu
PDBsum7ttu
PubMed35736238
UniProtQ2FXT0|RL27_STAA8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]