Structure of PDB 7o9k Chain I Binding Site BS02

Receptor Information
>7o9k Chain I (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGL
IRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPN
QVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLG
GCIDDTILSRQGFINYSKLPSLPLVQGELVGGLTCLTAQTHSLLQHQPLQ
LTTLLDQYIREQ
Ligand information
>7o9k Chain t4 (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKIQQLVQDIASLTLLEISDLNELLKKTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o9k Structural basis for late maturation steps of the human mitoribosomal large subunit.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		L214 T218 L221
Binding residue
(residue number reindexed from 1)		L186 T190 L193
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o9k, PDBe:7o9k, PDBj:7o9k
PDBsum7o9k
PubMed34135318
UniProtQ7Z7H8|RM10_HUMAN Large ribosomal subunit protein uL10m (Gene Name=MRPL10)

[Back to BioLiP]