Structure of PDB 7nad Chain I Binding Site BS02

Receptor Information
>7nad Chain I (length=334) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEEKILQLKEDIADLVTKVMEEPEENTAALGRLCKMVESKNPNTCKFSML
ALVPVFKSIIPGYRIRPLTETEKKEKVSKEVSKLRNFEQALVYNYKNYVG
RLQSLSKTPSNAAPIQVSLGILATQAAKELISTASHFNFRTDIFTLLLRR
ICKPRISTDPTSIQIIQTFETLLNEDEEGSISFEILRIFNKILKTRNFNI
EESVLNMLLSLDVLHDYDPNTKLKGNVSAPKLKKKDRVHLSKKQRKARKE
MQQIEEEMRNAEQAVSAEERERNQSEILKIVFTIYLNILKNNAKTLIGSV
LEGLTKFGNMANYRSLRLADPLNNEIIKPSVNVS
Ligand information
>7nad Chain G (length=19) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LSRYVKWPEYVRVQRQKKI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nad Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		E201 K202
Binding residue
(residue number reindexed from 1)		E72 K73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006270 DNA replication initiation
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005656 nuclear pre-replicative complex
GO:0005730 nucleolus
GO:0030691 Noc2p-Noc3p complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nad, PDBe:7nad, PDBj:7nad
PDBsum7nad
PubMed36482249
UniProtQ07896|NOC3_YEAST Nucleolar complex-associated protein 3 (Gene Name=NOC3)

[Back to BioLiP]