Structure of PDB 6zbu Chain I Binding Site BS02

Receptor Information
>6zbu Chain I (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLYLRGGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHK
TVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNL
REGNIMAVMATAMYLQMEHVVDTCRKFIKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zbu Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution2.46 Å
Binding residue
(original residue number in PDB)		D6 S7 Q8 I9 Q10 F11 T12 R13 H14 D17 N21 R24 L25 R28
Binding residue
(residue number reindexed from 1)		D9 S10 Q11 I12 Q13 F14 T15 R16 H17 D20 N24 R27 L28 R31
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6zbu, PDBe:6zbu, PDBj:6zbu
PDBsum6zbu
PubMed33708392
UniProtO75376;
P41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]