Structure of PDB 6wj6 Chain I Binding Site BS02

Receptor Information

>6wj6 Chain I (length=35) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa)

LTLKIAVYIVVGLFISLFIFGFLSSDPTRNPGRKD

Ligand information

• Ligand ID: FME
• InChI: InChI=1S/C6H11NO3S/c1-11-3-2-5(6(9)10)7-4-8/h4-5H,2-3H2,1H3,(H,7,8)(H,9,10)/t5-/m0/s1
• InChIKey: PYUSHNKNPOHWEZ-YFKPBYRVSA-N
• SMILES:
  CACTVS 3.341: CSCC[C@H](NC=O)C(O)=O
  CACTVS 3.341: CSCC[CH](NC=O)C(O)=O
  ACDLabs 10.04: O=CNC(C(=O)O)CCSC
  OpenEye OEToolkits 1.5.0: CSCCC(C(=O)O)NC=O
  OpenEye OEToolkits 1.5.0: CSCC[C@@H](C(=O)O)NC=O
• Formula: C6 H11 N O3 S
• Name: N-FORMYLMETHIONINE
• DrugBank: DB04464
• ZINC: ZINC000001529464
• PDB chain: 6wj6 Chain I Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6wj6 Cryo-EM Structure of Monomeric Photosystem II from Synechocystis sp. PCC 6803 Lacking the Water-Oxidation Complex
• Resolution: 2.58 Å
• Binding residue (original residue number in PDB): L2 T3 L4 K5
• Binding residue (residue number reindexed from 1): L1 T2 L3 K4
• Annotation score: 1

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030096 plasma membrane-derived thylakoid photosystem II
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:6wj6, PDBe:6wj6, PDBj:6wj6
• PDBsum: 6wj6
• UniProt: Q54697|PSBI_SYNY3 Photosystem II reaction center protein I (Gene Name=psbI)