Structure of PDB 6t83 Chain I Binding Site BS02

Receptor Information
>6t83 Chain I (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETA
MKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA
YVRLTADYDALDIANRIGYI
Ligand information
>6t83 Chain Ca (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		T37 L38 H53 Y54 R56 K61 M88 K89
Binding residue
(residue number reindexed from 1)		T15 L16 H31 Y32 R34 K39 M66 K67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t83, PDBe:6t83, PDBj:6t83
PDBsum6t83
PubMed31858614
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]