Structure of PDB 6n7p Chain I Binding Site BS02

Receptor Information
>6n7p Chain I (length=192) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSTPAAEQRKLVEQLMGLHDPKICKSYLVGECPYDLFQGTKQSLGKCPQM
HLTKHKIQYEREVKQGKTFPEFEREYLAILSRFVNECNGQISVALQNLKH
TAEERMKIQQVTEELDVLDLISKRKEVAKRVRNITENVGQSAQQKLQVCE
VCGAYLSRLDTDRRLADHFLGKIHLGYVKMREDYDRLMKNNR
Ligand information
>6n7p Chain r (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuagaaagguaugucuaaagu
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n7p A unified mechanism for intron and exon definition and back-splicing.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
A194 D212 R216
Binding residue
(residue number reindexed from 1)
A142 D160 R164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
Biological Process
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006376 mRNA splice site recognition
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6n7p, PDBe:6n7p, PDBj:6n7p
PDBsum6n7p
PubMed31485080
UniProtQ07508|LUC7_YEAST Protein LUC7 (Gene Name=LUC7)

[Back to BioLiP]