Structure of PDB 5xon Chain I Binding Site BS02

Receptor Information

>5xon Chain I (length=111) Species: 644223 (Komagataella phaffii GS115)

SFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNI
GETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYV
CLNCKKTFRDE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5xon Chain I Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5xon Structure of the complete elongation complex of RNA polymerase II with basal factors
• Resolution: 3.83 Å
• Binding residue (original residue number in PDB): C7 C10 C32
• Binding residue (residue number reindexed from 1): C5 C8 C30
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001193 maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
• GO:0006283 transcription-coupled nucleotide-excision repair
• GO:0006351 DNA-templated transcription
• GO:0006367 transcription initiation at RNA polymerase II promoter

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005665 RNA polymerase II, core complex
• GO:0005730 nucleolus

External links

• PDB: RCSB:5xon, PDBe:5xon, PDBj:5xon
• PDBsum: 5xon
• PubMed: 28775211
• UniProt: C4QY79