Structure of PDB 5wfk Chain I Binding Site BS02

Receptor Information

>5wfk Chain I (length=141) Species: 83333 (Escherichia coli K-12)

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

Ligand information

>5wfk Chain y (length=76)

gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca

<<<<<<<..<<<<........>>>>.<...<.......>..>......<<
<<<.......>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5wfk Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): S20 P21 P25
• Binding residue (residue number reindexed from 1): S20 P21 P25

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination
• GO:0015968 stringent response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5wfk, PDBe:5wfk, PDBj:5wfk
• PDBsum: 5wfk
• PubMed: 29733411
• UniProt: P0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)