Structure of PDB 5o5j Chain I Binding Site BS02

Receptor Information
>5o5j Chain I (length=126) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIQTVGRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVT
VDRVDQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFL
TRDPRAIERKKYGLKKARKAPQYSKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o5j The Complete Structure of the Mycobacterium smegmatis 70S Ribosome.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		K149 R150
Binding residue
(residue number reindexed from 1)		K125 R126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o5j, PDBe:5o5j, PDBj:5o5j
PDBsum5o5j
PubMed28683309
UniProtA0QSP9|RS9_MYCS2 Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]