Structure of PDB 5jut Chain I Binding Site BS02

Receptor Information
>5jut Chain I (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>5jut Chain D (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jut Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		A2 K8 Y12 S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 V52 R54 T56 N57 K58 Q63 I69 G71 D72 V73 V74 A77 Y79 T93 N94 W95 R152 T155 G156 A157 R158 P181 Y198 H203 V204 Y207 E210 R218 E221 L222 F253 F260 K262 Q264 Y265 A266 E268 S269 Y272 R273 Q274 T275 K276 L277 K279 R282 R285 V286
Binding residue
(residue number reindexed from 1)		A1 K7 Y11 S12 S13 T17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 V51 R53 T55 N56 K57 Q62 I68 G70 D71 V72 V73 A76 Y78 T92 N93 W94 R151 T154 G155 A156 R157 P180 Y197 H202 V203 Y206 E209 R217 E220 L221 F252 F259 K261 Q263 Y264 A265 E267 S268 Y271 R272 Q273 T274 K275 L276 K278 R281 R284 V285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jut, PDBe:5jut, PDBj:5jut
PDBsum5jut
PubMed27159452
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]