BioLiP

Receptor Information

>5jus Chain I (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

>5jus Chain D (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

.<<<<<<<.....<<<<<<<<.....<<.<<.....<.....>..>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>.>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jus Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	A2 K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 E25 K27 T28 R33 R50 V52 T56 N57 K58 Q63 I65 I69 T70 G71 D72 V73 V74 Y79 T93 N94 W95 R152 T154 T155 G156 A157 R158 P181 F185 Y198 Y207 F223 F253 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 T275 K276 K279 R282 R285 V286 K289 I290
Binding residue (residue number reindexed from 1)	A1 K7 S9 S12 S13 F15 T17 F19 R20 R21 R23 E24 K26 T27 R32 R49 V51 T55 N56 K57 Q62 I64 I68 T69 G70 D71 V72 V73 Y78 T92 N93 W94 R151 T153 T154 G155 A156 R157 P180 F184 Y197 Y206 F222 F252 F259 K261 Q263 Y264 A265 E267 S268 K269 Y271 R272 Q273 T274 K275 K278 R281 R284 V285 K288 I289

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:5jus, PDBe:5jus, PDBj:5jus
PDBsum	5jus
PubMed	27159452
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]

Structure of PDB 5jus Chain I Binding Site BS02