Structure of PDB 5j0n Chain I Binding Site BS02

Receptor Information
>5j0n Chain I (length=96) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGN
FDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPK
Ligand information
>5j0n Chain D (length=99) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatattttgactgatagtgacctgttcgttgcaacaaattgataagc
aatgcttttttagaattccaacttattgtaaaaaagcaggcttcaacgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j0n Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
Resolution11.0 Å
Binding residue
(original residue number in PDB)		S47 P61 R63 P65 K66 R82
Binding residue
(residue number reindexed from 1)		S46 P60 R62 P64 K65 R81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0032993 protein-DNA complex
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j0n, PDBe:5j0n, PDBj:5j0n
PDBsum5j0n
PubMed27223329
UniProtP0A6X7|IHFA_ECOLI Integration host factor subunit alpha (Gene Name=ihfA)

[Back to BioLiP]