Structure of PDB 5gm6 Chain I Binding Site BS02

Receptor Information

>5gm6 Chain I (length=102) Species: 559292 (Saccharomyces cerevisiae S288C)

MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEQVR
SNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEK
SS

Ligand information

>5gm6 Chain E (length=103)

guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua

<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): G6 G8 S9 K10 Q25
• Binding residue (residue number reindexed from 1): G6 G8 S9 K10 Q25

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0071004 U2-type prespliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
• PDBsum: 5gm6
• PubMed: 27445306
• UniProt: Q07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)