Structure of PDB 3j9m Chain I Binding Site BS02

Receptor Information
>3j9m Chain I (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPGLIRLLRREIAAV
FQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSK
YQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQ
GFINYSKL
Ligand information
>3j9m Chain l (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SREYWRRLRKQNIWRHNRLSKNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j9m Ribosome. The structure of the human mitochondrial ribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		G77 L78
Binding residue
(residue number reindexed from 1)		G38 L39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9m, PDBe:3j9m, PDBj:3j9m
PDBsum3j9m
PubMed25838379
UniProtQ7Z7H8|RM10_HUMAN Large ribosomal subunit protein uL10m (Gene Name=MRPL10)

[Back to BioLiP]