Structure of PDB 3j7r Chain I Binding Site BS02

Receptor Information
>3j7r Chain I (length=213) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGH
MVSDEYEQLSSEALEAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINK
MLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEA
LRRAKFKFPGRQKIHISKKWGFTKFNADEFENMVAKKCLIPDGCGVKYVP
NHGPLDKWRVLHS
Ligand information
>3j7r Chain 7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y11 E56 Y57 Y199 N202 H203 G204 L206
Binding residue
(residue number reindexed from 1)		Y10 E55 Y56 Y198 N201 H202 G203 L205
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0006417 regulation of translation
GO:1990403 embryonic brain development
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum3j7r
PubMed24930395
UniProtQ29195|RL10_PIG Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]