Structure of PDB 2y9h Chain I Binding Site BS02

Receptor Information
>2y9h Chain I (length=195) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRL
EPAEPPVVLVQTLTEPDWSVLDGYAQVFPPKPFHPALKPGQRLRFRLRAN
PAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLERGPWVQILQDTFL
ELLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y9h An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y23 R43 K105 R106 L107 A108 K112 R113 R128 R129 L169 Q170 K200 L202
Binding residue
(residue number reindexed from 1)		Y25 R45 K103 R104 L105 A106 K110 R111 R126 R127 L153 Q154 K184 L186
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2y9h, PDBe:2y9h, PDBj:2y9h
PDBsum2y9h
PubMed21572442
UniProtQ53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)

[Back to BioLiP]