Structure of PDB 2irf Chain I Binding Site BS02

Receptor Information

>2irf Chain I (length=109) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPL
FRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNN
AFRVYRMLP

Ligand information

>2irf Chain E (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcactttcacut

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2irf Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R407 M408 W458 T462 K464 N480 C483 A484 S487
Binding residue (residue number reindexed from 1)	R3 M4 W54 T58 K60 N76 C79 A80 S83
Binding affinity	PDBbind-CN: Kd=0.17uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2irf, PDBe:2irf, PDBj:2irf
PDBsum	2irf
PubMed	10487755
UniProt	P23906\|IRF2_MOUSE Interferon regulatory factor 2 (Gene Name=Irf2)

[Back to BioLiP]