Structure of PDB 1k78 Chain I Binding Site BS02

Receptor Information
>1k78 Chain I (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVS
SINRIIRT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k78 Structural studies of Ets-1/Pax5 complex formation on DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		G84 G85 S86 K87 P88 K89 V90 A91 S131 S133 S134 R137
Binding residue
(residue number reindexed from 1)		G1 G2 S3 K4 P5 K6 V7 A8 S48 S50 S51 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1k78, PDBe:1k78, PDBj:1k78
PDBsum1k78
PubMed11779502
UniProtQ02548|PAX5_HUMAN Paired box protein Pax-5 (Gene Name=PAX5)

[Back to BioLiP]