Structure of PDB 8q3x Chain HHH Binding Site BS02

Receptor Information
>8q3x Chain HHH (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>8q3x Chain JJJ (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q3x Viral peptide conjugates for metal-warhead delivery to chromatin.
Resolution2.301 Å
Binding residue
(original residue number in PDB)
S29 Y39 I51 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
S2 Y12 I24 S25 S26 R56 S57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:8q3x, PDBe:8q3x, PDBj:8q3x
PDBsum8q3x
PubMed38495982
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]