Structure of PDB 8cmj Chain HH Binding Site BS02

Receptor Information
>8cmj Chain HH (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>8cmj Chain BB (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cmj Cryo-EM analysis of eukaryotic ribosome translocation intermediates
Resolution3.79 Å
Binding residue
(original residue number in PDB)		S10 S13 S14 F16 Q17 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 Q63 I65 D72 Y79 H90 G91 N94 W95 Q151 R152 T154 T155 R158 Y198 H203 Q206 Y207 E221 L222 F223 K258 F260 K262 Y265 A266 E268 S269 Y272 Q274 K276 L277 K279 R282 R285
Binding residue
(residue number reindexed from 1)		S9 S12 S13 F15 Q16 T17 F19 R20 R21 R23 T27 Y29 R32 R49 R53 T55 N56 K57 Q62 I64 D71 Y78 H89 G90 N93 W94 Q150 R151 T153 T154 R157 Y197 H202 Q205 Y206 E220 L221 F222 K257 F259 K261 Y264 A265 E267 S268 Y271 Q273 K275 L276 K278 R281 R284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cmj, PDBe:8cmj, PDBj:8cmj
PDBsum8cmj
PubMed38030725
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]