Structure of PDB 8cgn Chain HH Binding Site BS02

Receptor Information
>8cgn Chain HH (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>8cgn Chain BB (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cgn mRNA reading frame maintenance during eukaryotic ribosome translocation
Resolution2.28 Å
Binding residue
(original residue number in PDB)		D6 K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 V52 R54 T56 N57 K58 I61 Q63 I65 I69 T70 D72 V74 H90 G91 N94 W95 Q151 R152 T154 T155 G156 A157 R158 Y198 H203 V204 Y207 R218 E221 K224 F253 P255 T256 K258 K262 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 R282 R285 V286 K289
Binding residue
(residue number reindexed from 1)		D5 K7 S9 S12 S13 F15 T17 F19 R20 R21 R23 K26 T27 Y29 R32 V51 R53 T55 N56 K57 I60 Q62 I64 I68 T69 D71 V73 H89 G90 N93 W94 Q150 R151 T153 T154 G155 A156 R157 Y197 H202 V203 Y206 R217 E220 K223 F252 P254 T255 K257 K261 Y264 A265 E267 S268 K269 Y271 R272 Q273 K275 L276 R281 R284 V285 K288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cgn, PDBe:8cgn, PDBj:8cgn
PDBsum8cgn
PubMed38030725
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]