Structure of PDB 9b3p Chain H Binding Site BS02

Receptor Information
>9b3p Chain H (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>9b3p Chain J (length=128) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacg
cacgtacgcgctgtcccccgcgttttaaccgccaaggggattactcccta
gtctccaggcacgtgtcagatatataca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b3p Structural and Biochemical Characterization of the Nucleosome Containing Variants H3.3 and H2A.Z
Resolution3.0 Å
Binding residue
(original residue number in PDB)
K34 E35 I39 Y40
Binding residue
(residue number reindexed from 1)
K2 E3 I7 Y8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:9b3p, PDBe:9b3p, PDBj:9b3p
PDBsum9b3p
PubMed38920622
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]