Structure of PDB 8yv8 Chain H Binding Site BS02

Receptor Information

>8yv8 Chain H (length=92) Species: 9606 (Homo sapiens)

RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA

Ligand information

>8yv8 Chain J (length=132)

tctgacacgtgcctggagactagggagtaatccccttggcggttaaaacg
cgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcgcgaccgggattctgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8yv8 CDCA7 is a hemimethylated DNA adaptor for the nucleosome remodeler HELLS
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): Y39 S52 S53 R83 S84 T85
• Binding residue (residue number reindexed from 1): Y10 S23 S24 R54 S55 T56

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003677 DNA binding
• GO:0005515 protein binding

Biological Process

• GO:0002227 innate immune response in mucosa
• GO:0019731 antibacterial humoral response
• GO:0031640 killing of cells of another organism
• GO:0042742 defense response to bacterium
• GO:0050829 defense response to Gram-negative bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0000786 nucleosome
• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005829 cytosol

External links

• PDB: RCSB:8yv8, PDBe:8yv8, PDBj:8yv8
• PDBsum: 8yv8
• UniProt: O60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)