Structure of PDB 8wic Chain H Binding Site BS02

Receptor Information
>8wic Chain H (length=180) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAKL
INGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWEF
LDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDRP
RGMDITVVTTATNDAEGRALLRALGFPFKE
Ligand information
>8wic Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuacggcgguccauagcggcagggaaacgcccggucccaucccgaaccc
ggaagcuaagccugccagcgccgaugauacuacccauccggguggaaaag
uaggacaccgccgaaca
<<<.<<<<<<<.....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.....
..>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wic Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
N31 M33 Q34 Q70 K71 E73 V74 R76 R95 T97 R99
Binding residue
(residue number reindexed from 1)
N25 M27 Q28 Q64 K65 E67 V68 R70 R89 T91 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8wic, PDBe:8wic, PDBj:8wic
PDBsum8wic
PubMed38245551
UniProtA0QSG1|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]