Structure of PDB 8wi8 Chain H Binding Site BS02

Receptor Information

>8wi8 Chain H (length=182) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAK
LINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWE
FLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDR
PRGMDITVVTTATNDAEGRALLRALGFPFKEN

Ligand information

>8wi8 Chain B (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guuacggcgguccauagcggcagggaaacgcccggucccaucccgaaccc
ggaagcuaagccugccagcgccgaugauacuacccauccggguggaaaag
uaggacaccgccgaacac

<<<.<<<<<<<.....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.....
..>>..>>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8wi8 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	N31 M33 Q34 Q70 K71 E73 V74 R76 T97 R99
Binding residue (residue number reindexed from 1)	N26 M28 Q29 Q65 K66 E68 V69 R71 T92 R94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wi8, PDBe:8wi8, PDBj:8wi8
PDBsum	8wi8
PubMed	38245551
UniProt	A0QSG1\|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]