Structure of PDB 8vis Chain H Binding Site BS02

Receptor Information
>8vis Chain H (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPR
DWIATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTK
DIHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDV
CNAPHSYNGAILSGMLCAGVPQGGVDACQGDSGGPLVQEDSRRLWFIVGI
VSWGDQCGLPDKPGVYTRVTAYLDWIRQQTGIE
Ligand information
>8vis Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANWLINECGAGPDLITDDDDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vis Human TMPRSS11D complexed with a disulfide-linked autoinhibitory DDDDK peptide
Resolution1.59 Å
Binding residue
(original residue number in PDB)		S197 N219 F284 T285 K286 H289 S290 V291 C292 E375 R379 L380 W381
Binding residue
(residue number reindexed from 1)		S11 N33 F98 T99 K100 H103 S104 V105 C106 E189 R193 L194 W195
Enzymatic activity
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8vis, PDBe:8vis, PDBj:8vis
PDBsum8vis
PubMed
UniProtO60235|TM11D_HUMAN Transmembrane protease serine 11D (Gene Name=TMPRSS11D)

[Back to BioLiP]