Structure of PDB 8u3b Chain H Binding Site BS02

Receptor Information
>8u3b Chain H (length=66) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKL
KSRVEAAVWVHQERIF
Ligand information
>8u3b Chain 2 (length=69) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgctgccgcgaattccgtttcagggtacgcctgataatttgcattttaa
ataccatttattggttact
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u3b Structural basis for transcription activation by the nitrate-responsive regulator NarL.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		L156 E160 T183 S185 T186 K188 H190 H193
Binding residue
(residue number reindexed from 1)		L6 E10 T33 S35 T36 K38 H40 H43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8u3b, PDBe:8u3b, PDBj:8u3b
PDBsum8u3b
PubMed38197271
UniProtP0AF28|NARL_ECOLI Nitrate/nitrite response regulator protein NarL (Gene Name=narL)

[Back to BioLiP]