Structure of PDB 8rkg Chain H Binding Site BS02

Receptor Information
>8rkg Chain H (length=164) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFNL
ENQRLYVADLRLVSQFGSPRISIDTPMICARDSPSCNSTHATVLIPFFGG
VLTGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRGDRNDVLVLTFI
YYGKTVPMLISLVC
Ligand information
>8rkg Chain S (length=28) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSSVVTCTKDSMTVRIPRTLSGFDDEIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D195 P196 Y197 Y198 L199 T200 V201 Q202 A203 Y205 M242 I243 C244 R246 S248 P326 L328
Binding residue
(residue number reindexed from 1)		D30 P31 Y32 Y33 L34 T35 V36 Q37 A38 Y40 M77 I78 C79 R81 S83 P157 L159
Enzymatic activity
Enzyme Commision number ?
External links