Structure of PDB 8pp6 Chain H Binding Site BS02

Receptor Information
>8pp6 Chain H (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Ligand information
>8pp6 Chain J (length=156) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aatacacaggatgtatatatctgacacgtgcctggagattagggagtaat
ccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcgg
tgctagagctgtctacgaccaattgagcggcctcggcaccgggattctcc
aggtcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pp6 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
Resolution3.18 Å
Binding residue
(original residue number in PDB)
R28 R30 Y37
Binding residue
(residue number reindexed from 1)
R1 R3 Y10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pp6, PDBe:8pp6, PDBj:8pp6
PDBsum8pp6
PubMed38528151
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]