Structure of PDB 8p94 Chain H Binding Site BS02

Receptor Information
>8p94 Chain H (length=372) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSY
VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV
LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVM
DSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT
AEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNE
RFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGT
TMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ
QMWISKQEYDESGPSIVHRKCF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p94 Molecular visualization of how cortactin stabilizes Arp2/3-complex nucleated actin branches
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E72 I75 T77 P112 R177 D179
Binding residue
(residue number reindexed from 1)		E69 I72 T74 P109 R174 D176
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0098973 structural constituent of postsynaptic actin cytoskeleton
Biological Process
GO:0007409 axonogenesis
GO:0048870 cell motility
GO:0098974 postsynaptic actin cytoskeleton organization
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0030424 axon
GO:0032991 protein-containing complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0045202 synapse
GO:0097433 dense body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p94, PDBe:8p94, PDBj:8p94
PDBsum8p94
PubMed38267598
UniProtQ6QAQ1|ACTB_PIG Actin, cytoplasmic 1 (Gene Name=ACTB)

[Back to BioLiP]