Structure of PDB 8oz0 Chain H Binding Site BS02

Receptor Information
>8oz0 Chain H (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPP
TYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCP
ECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENS
Ligand information
>8oz0 Chain y (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcagaguggcgcagcggaagcgugcugggcccauaacccagaggucgau
ggaucgaaaccauccucugcuacca
<<<<<<...<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oz0 The structure of a human translation initiation complex reveals two independent roles for the helicase eIF4A.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		N30 R73
Binding residue
(residue number reindexed from 1)		N30 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005092 GDP-dissociation inhibitor activity
GO:0005096 GTPase activator activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0045296 cadherin binding
GO:0071074 eukaryotic initiation factor eIF2 binding
Biological Process
GO:0001732 formation of cytoplasmic translation initiation complex
GO:0006412 translation
GO:0006413 translational initiation
GO:0006446 regulation of translational initiation
GO:0042255 ribosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oz0, PDBe:8oz0, PDBj:8oz0
PDBsum8oz0
PubMed38287194
UniProtP55010|IF5_HUMAN Eukaryotic translation initiation factor 5 (Gene Name=EIF5)

[Back to BioLiP]