Structure of PDB 8jkq Chain H Binding Site BS02

Receptor Information

>8jkq Chain H (length=109) Species: 9606 (Homo sapiens)

GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALF
KAWALFKGKFREGIDKPDPPTWKRRLRCALNKSNDFEELVERSQLDISDP
YKVYRIVPE

Ligand information

>8jkq Chain E (length=19)

ggtttctcggtgtcagttg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8jkq Molecular basis for the functional roles of the multimorphic T95R mutation of IRF4 causing human autosomal dominant combined immunodeficiency.
• Resolution: 3.09 Å
• Binding residue (original residue number in PDB): G22 L24 H56 G58 Q60 W74 K78 K80 R96 K103
• Binding residue (residue number reindexed from 1): G1 L3 H35 G37 Q39 W53 K57 K59 R75 K82

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:8jkq, PDBe:8jkq, PDBj:8jkq
• PDBsum: 8jkq
• PubMed: 37683642
• UniProt: F2Z3D5