Structure of PDB 8jko Chain H Binding Site BS02

Receptor Information
>8jko Chain H (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDDAALFKAWAL
FKGKFREGIDKPDPPTWKRRLRCALNKSNDFEELVERSQLDISDPYKVYR
IVPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jko Molecular basis for the functional roles of the multimorphic T95R mutation of IRF4 causing human autosomal dominant combined immunodeficiency.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		G22 K23 L24 H56 W74 R96 A100 K103
Binding residue
(residue number reindexed from 1)		G1 K2 L3 H35 W48 R70 A74 K77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8jko, PDBe:8jko, PDBj:8jko
PDBsum8jko
PubMed37683642
UniProtF2Z3D5

[Back to BioLiP]