Structure of PDB 8evi Chain H Binding Site BS02

Receptor Information
>8evi Chain H (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>8evi Chain I (length=143) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctgatcttcagctggttgctgagagttgcagcattgctgagtcttagca
atggatacttcccgattcccctcacaaaaataggtcagtctgtctggcta
gttctgtacttgcagacacagggcatgtggggttcctattttt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8evi Structural basis of cooperative targeting of the CX3CR1 nucleosome
Resolution2.64 Å
Binding residue
(original residue number in PDB)
R30 Y39 I51 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)
R3 Y12 I24 S25 S26 R56 S57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002227 innate immune response in mucosa
GO:0006334 nucleosome assembly
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8evi, PDBe:8evi, PDBj:8evi
PDBsum8evi
PubMed38267599
UniProtQ16778|H2B2E_HUMAN Histone H2B type 2-E (Gene Name=H2BC21)

[Back to BioLiP]