Structure of PDB 8ebw Chain H Binding Site BS02

Receptor Information
>8ebw Chain H (length=532) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IETPEQAKTRERSEKIKLEFETYLRRAMKRFNKGVHEDTHKVHLLCLLAN
GFYRNNICSQPDLHAIGLSIIPARFTRVLPRDVDTYYLSNLVKWFIGTFT
VNAELSASEQDNLQTTLERRFAIYSARDDEELVHIFLLILRALQLLTRLV
LSLQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDG
WVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQ
AKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVY
SRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLRE
ENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNL
PNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWE
NEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGPGTSSQAEAA
RILAASWPQNREDEEKQKLKAAASHLFPFEKL
Ligand information
>8ebw Chain M (length=53) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggcatagatatcgcacgtctattatcctcagcgcaatcagctgtgacta
cct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ebw Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.
Resolution5.6 Å
Binding residue
(original residue number in PDB)		R192 R196 T636 A637 I638 R651 R671 D688 F710 N712 F756 N758 Y760 I794 F797 F799 S804 H805 P806
Binding residue
(residue number reindexed from 1)		R26 R30 T260 A261 I262 R275 R295 D312 F334 N336 F380 N382 Y384 I418 F421 F423 S428 H429 P430
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000404 heteroduplex DNA loop binding
GO:0000405 bubble DNA binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0044877 protein-containing complex binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140612 DNA damage sensor activity
Biological Process
GO:0000720 pyrimidine dimer repair by nucleotide-excision repair
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006298 mismatch repair
GO:0006974 DNA damage response
GO:0009410 response to xenobiotic stimulus
GO:0010224 response to UV-B
GO:0010996 response to auditory stimulus
GO:0031573 mitotic intra-S DNA damage checkpoint signaling
GO:0045893 positive regulation of DNA-templated transcription
GO:0070914 UV-damage excision repair
GO:1901990 regulation of mitotic cell cycle phase transition
Cellular Component
GO:0000109 nucleotide-excision repair complex
GO:0000111 nucleotide-excision repair factor 2 complex
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0071942 XPC complex
GO:0090734 site of DNA damage

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ebw, PDBe:8ebw, PDBj:8ebw
PDBsum8ebw
PubMed37076618
UniProtQ01831|XPC_HUMAN DNA repair protein complementing XP-C cells (Gene Name=XPC)

[Back to BioLiP]