Structure of PDB 7zai Chain H Binding Site BS02

Receptor Information
>7zai Chain H (length=214) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKPLSERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRH
AKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAY
EVVKEAFKIIEKRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVD
ISPMRRLDVALRNIALGASAKCYRTKMSFAEALAEEIILAANKDPKSYAY
SKKLEIERIAESSR
Ligand information
>7zai Chain 5 (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uggaggugauuuaaaugccaaa
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zai Role of aIF5B in archaeal translation initiation.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		F141 G142 G143
Binding residue
(residue number reindexed from 1)		F140 G141 G142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zai, PDBe:7zai, PDBj:7zai
PDBsum7zai
PubMed35694843
UniProtQ9V109|RS7_PYRAB Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]