Structure of PDB 7ta6 Chain H Binding Site BS02

Receptor Information
>7ta6 Chain H (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPSDKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQ
VLFKGQGCPSTHVLLTHTISRIAKVNLLSAIKSPCKPWYEPIYLGGVFQL
EKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Ligand information
>7ta6 Chain P (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KLGWCIGEGGTDPNLNHGQFRGKILMCWK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ta6 Trimer-to-Monomer Disruption Mechanism for a Potent, Protease-Resistant Antagonist of Tumor Necrosis Factor-alpha Signaling.
Resolution2.67 Å
Binding residue
(original residue number in PDB)		P8 K11 H15 L57 Q61 Y119 V123 Q149 Y151 I155 A156 L157
Binding residue
(residue number reindexed from 1)		P2 K5 H9 L46 Q50 Y93 V97 Q123 Y125 I129 A130 L131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0006955 immune response
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ta6, PDBe:7ta6, PDBj:7ta6
PDBsum7ta6
PubMed35613436
UniProtP01375|TNFA_HUMAN Tumor necrosis factor (Gene Name=TNF)

[Back to BioLiP]