Structure of PDB 7ssa Chain H Binding Site BS02

Receptor Information
>7ssa Chain H (length=92) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
Ligand information
>7ssa Chain J (length=137) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatatatctgagacgtccctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctggtcacgtga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ssa Basic helix-loop-helix pioneer factors interact with the histone octamer to invade nucleosomes and generate nucleosome-depleted regions.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R36 Y45 Q59 K89 S90 T91
Binding residue
(residue number reindexed from 1)		R1 Y10 Q24 K54 S55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006301 postreplication repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ssa, PDBe:7ssa, PDBj:7ssa
PDBsum7ssa
PubMed36996811
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]