Structure of PDB 7sba Chain H Binding Site BS02

Receptor Information
>7sba Chain H (length=238) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKIYRCKLTLHDNVFFASREMGILYETEKYFHNWALSYAFFKGTIIPHPY
GLVGQNAQTPAYLDRDREQNLLHLNDSGIYVFPAQPIHWSYQINTFKAAQ
SAYYGRSVQFGGKGATKNYPINYGRAKELAVGSEFLTYIVSQKELDLPVW
IRLGKWSSKIRVEVEAIAPDQIKTASGVYVCNHPLNPLDCPANQQILLYN
RVVMPPSSLFSQSQLQGDYWQIDRNTFLPQGFHYGATT
Ligand information
>7sba Chain Z (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugaaacgauuguugugccccuggcggucgcuuucaaugccu
...........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sba Structural rearrangements allow nucleic acid discrimination by type I-D Cascade.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		F17 A18 S19 F32 H33 A36 Y39 K43 L53 A58 Q59 T60 P61 Y63 Q70 T96 F97 K98 A99 A100 P121 Y124 R153 L154 K156 M205 P206 P207
Binding residue
(residue number reindexed from 1)		F16 A17 S18 F31 H32 A35 Y38 K42 L52 A57 Q58 T59 P60 Y62 Q69 T95 F96 K97 A98 A99 P120 Y123 R152 L153 K155 M204 P205 P206
Enzymatic activity
Enzyme Commision number ?
External links