Structure of PDB 7phx Chain H Binding Site BS02

Receptor Information
>7phx Chain H (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
Ligand information
>7phx Chain I (length=24) Species: 37546 (Glossina morsitans morsitans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GEPGAPIDFDEGGTPLHEIPGIRL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7phx Synthesis and evaluation of peptidic thrombin inhibitors bearing acid-stable sulfotyrosine analogues.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
H363 Y367 P369 W370 R409 E414 N415 L416 R418 R443 L450 Q451 A452 E489 R490 I499 D503 N504 A520 E522 S525 W547 G548 G550 H562 F564 R565 K567 K568
Binding residue
(residue number reindexed from 1)
H43 Y47 P49 W50 R89 E94 N95 L96 R98 R123 L130 Q131 A132 E162 R163 I172 D176 N177 A193 E195 S198 W220 G221 G223 H235 F237 R238 K240 K241
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7phx, PDBe:7phx, PDBj:7phx
PDBsum7phx
PubMed34596182
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]