Structure of PDB 7k6q Chain H Binding Site BS02

Receptor Information
>7k6q Chain H (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTCYTSA
Ligand information
>7k6q Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggagaatccgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k6q Regulation of the Dot1 histone H3K79 methyltransferase by histone H4K16 acetylation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
T32 Y42 G53 I54 S55 S56 R86 S87 T88
Binding residue
(residue number reindexed from 1)
T1 Y11 G22 I23 S24 S25 R55 S56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7k6q, PDBe:7k6q, PDBj:7k6q
PDBsum7k6q
PubMed33479126
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]