Structure of PDB 7egr Chain H Binding Site BS02

Receptor Information

>7egr Chain H (length=206) Species: 6500 (Aplysia californica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVD
LVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQV
LSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSG
FEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLV
VKFRER

Ligand information

>7egr Chain R (length=13) Species: 101314 (Conus regius) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GCCSDPRCRYRCR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7egr Co-crystal structure of Ac-AChBPP in complex with RgIA
Resolution	2.503 Å
Binding residue (original residue number in PDB)	Q74 R76 D94 R96 M133 D176 D181 S183
Binding residue (residue number reindexed from 1)	Q56 R58 D76 R78 M115 D158 D163 S165

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0005216	monoatomic ion channel activity
GO:0005230	extracellular ligand-gated monoatomic ion channel activity

	Biological Process
GO:0006811	monoatomic ion transport
GO:0034220	monoatomic ion transmembrane transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7egr, PDBe:7egr, PDBj:7egr
PDBsum	7egr
PubMed
UniProt	Q8WSF8

[Back to BioLiP]