Structure of PDB 6x1s Chain H Binding Site BS02

Receptor Information
>6x1s Chain H (length=221) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVEESEGGLFKPTDTLTLTCTASGFSLSGHGVIWVRQAPGKGLEWIGSA
GAYGRIYYASWAKSRSTITRNTNLNTVTLKMTSLTAADTATYFCARRSDV
GTSVGFDSWGPGTLVTISSSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLV
KGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVT
CNVAHPATNTKVDKTVAPSTC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x1s Structural basis for differential recognition of phosphohistidine-containing peptides by 1-pHis and 3-pHis monoclonal antibodies.
Resolution1.65 Å
Binding residue
(original residue number in PDB)
G52 A53 Y54 Y58 R95 V98 S100A
Binding residue
(residue number reindexed from 1)
G51 A52 Y53 Y57 R97 V100 S103
External links