Structure of PDB 6vjn Chain H Binding Site BS02

Receptor Information

>6vjn Chain H (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HLQLQESGPGLVKPSETLSLTCAVSGGSSSDYWWSWIRQPPGKGLEWIGR
IDSIGNTYYNPSLRSRVTLSVDTSKNQFSLELTSVTAADTAVYYCARPYC
AIGRCYESWGQGVLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEP

Ligand information

>6vjn Chain F (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EERKSKYRLI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6vjn Structurally related but genetically unrelated antibody lineages converge on an immunodominant HIV-1 Env neutralizing determinant following trimer immunization.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	I99 G100
Binding residue (residue number reindexed from 1)	I102 G103

External links

PDB	RCSB:6vjn, PDBe:6vjn, PDBj:6vjn
PDBsum	6vjn
PubMed	34559844

[Back to BioLiP]