Structure of PDB 6s8e Chain H Binding Site BS02

Receptor Information
>6s8e Chain H (length=312) Species: 930945 (Sulfolobus islandicus REY15A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVLIKPLEPLMFRSQGEFEPLITGSHTAAQSLIIPRPSTIAGMLGYILF
NKSSGTGDWLSDLTNLLATIYGTFIETNGEYLFPLRMGNHLALVDQQHLI
NLPTLLEKEYERREKGIYELFYDKNKLFQIINHQDRIGISIDKSTRTVKE
HYLYSARYLAFKKEVNYVIFIDNDAISDKINGKIVNFGGENRIAKLEVDD
YKVDTSIEEEYYLALSPILIPDEALDNFLDNISDYVAMGKVDKISLGFDI
ANTKRKEMLTAILEGSIVKRSIIDFIKNEIKNDLRYRFSKYEKIGYNTLM
SLCKLALRKILS
Ligand information
>6s8e Chain V (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auugaaaguucaaagcuuagauacccuggagggaaaccagacuuaac
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s8e Structures of the Cmr-beta Complex Reveal the Regulation of the Immunity Mechanism of Type III-B CRISPR-Cas.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R15 S16 Q17 S40 T41 G44 M45 G47 Y48 F51 I138 G139 I140 S141 I142 R147 T148 V149 Y155 N187 G189 G190 E191 N192 G248 F249 D250 I251 R256 K257
Binding residue
(residue number reindexed from 1)		R14 S15 Q16 S39 T40 G43 M44 G46 Y47 F50 I137 G138 I139 S140 I141 R146 T147 V148 Y154 N186 G188 G189 E190 N191 G247 F248 D249 I250 R255 K256
Enzymatic activity
Enzyme Commision number ?
External links