Structure of PDB 6s8b Chain H Binding Site BS02

Receptor Information
>6s8b Chain H (length=304) Species: 930945 (Sulfolobus islandicus REY15A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVLIKPLEPLMFRSQGEFTAAQSLIIPRPSTIAGMLGYILFNKSSGTGD
WLSDLTNLLATIYGTFIETNGEYLFPLRMGNHLALVDQQHLINLPTLLEK
EYERREKGIYELFYDKNKLFQIINHQDRIGISIDKSTRTVKEHYLYSARY
LAFKKEVNYVIFIDNDAISDKINGKIVNFGGENRIAKLEVDDYKVDTSIE
EEYYLALSPILIPDEALDNFLDNISDYVAMGKVDKISLGFDIANTKRKEM
LTAILEGSIVKRSIIDFIKNEIKNDLRYRFSKYEKIGYNTLMSLCKLALR
KILS
Ligand information
>6s8b Chain V (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auugaaaguucaaagcuuagauacccuggagggaaaccagacuuaacac
.................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s8b Structures of the Cmr-beta Complex Reveal the Regulation of the Immunity Mechanism of Type III-B CRISPR-Cas.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		R15 S16 Q17 S40 T41 G44 M45 G47 Y48 F51 I138 G139 I140 S141 I142 R147 V149 Y153 Y155 N187 G189 G190 E191 G248 F249 D250 I251 K257
Binding residue
(residue number reindexed from 1)		R14 S15 Q16 S31 T32 G35 M36 G38 Y39 F42 I129 G130 I131 S132 I133 R138 V140 Y144 Y146 N178 G180 G181 E182 G239 F240 D241 I242 K248
Enzymatic activity
Enzyme Commision number ?
External links