Structure of PDB 6kbz Chain H Binding Site BS02

Receptor Information
>6kbz Chain H (length=220) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CGRFAQSQTREDYLALLARDIPYDPEPIGRYNVAPGTKVLLLSERDEHLH
LDPVFWGYAPGWWDKPPLINARVETAATSRMFKPLWQHGRAICFADGWFE
WKKEGDKKQPFFIYRADGQPIFMAAIGSTPFERGDEAEGFLIVTAAADQG
LVDIHDRRPLVLSPEAAREWMRQEISGKEASEIAASGCVPANQFSWHPVS
RAVGNVKNQGAELIQPVLEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kbz Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.
Resolution1.653 Å
Binding residue
(original residue number in PDB)		C2 G3 R4 P40 W67 K70 L73 N75 R77 S84 R85 M86 F87 W106 K113 T149 R162 G209 N210
Binding residue
(residue number reindexed from 1)		C1 G2 R3 P35 W62 K65 L68 N70 R72 S79 R80 M81 F82 W101 K108 T144 R157 G204 N205
Enzymatic activity
Enzyme Commision number 3.4.-.-
4.-.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0008233 peptidase activity
GO:0016829 lyase activity
GO:0160129 protein-DNA covalent cross-linking activity
Biological Process
GO:0006508 proteolysis
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0106300 protein-DNA covalent cross-linking repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6kbz, PDBe:6kbz, PDBj:6kbz
PDBsum6kbz
PubMed31504793
UniProtP76318|YEDK_ECOLI Abasic site processing protein YedK (Gene Name=yedK)

[Back to BioLiP]