Structure of PDB 6iy2 Chain H Binding Site BS02

Receptor Information
>6iy2 Chain H (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6iy2 Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaaaactgtgccgcagtcggccgacctgagggtcgccggggtctgcgg
ggggaccctctggaaagtgaaggataagtgacgagcggagacgggatggc
gaacagacacaaacacacaagaggtgaatgttaggactgttgcagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iy2 Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
Resolution3.47 Å
Binding residue
(original residue number in PDB)		R30 T32 R33 Y42 R86 S87 T88
Binding residue
(residue number reindexed from 1)		R2 T4 R5 Y14 R58 S59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6iy2, PDBe:6iy2, PDBj:6iy2
PDBsum6iy2
PubMed30867599
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]