Structure of PDB 6c0y Chain H Binding Site BS02

Receptor Information
>6c0y Chain H (length=108) Species: 53446 (Streptomyces cinnamoneus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVDIIRRIQELMVLCSLLPPDGKLREALELALALHEEPALARITPLTNLH
PFATKAWLETLWLGEGVSSEEKELVAWQNKSENMGPAIRELKNAEQQSGI
TLVARLTS
Ligand information
>6c0y Chain L (length=18) Species: 53446 (Streptomyces cinnamoneus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CKQACAFGPFPFVCDGNP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0y Substrate-assisted enzymatic formation of lysinoalanine in duramycin.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		K66 E70 L74 Q89 N90 S92 G96
Binding residue
(residue number reindexed from 1)		K55 E59 L63 Q78 N79 S81 G85
Enzymatic activity
Enzyme Commision number ?
External links